}, ] }, "actions" : [ "actions" : [ "action" : "rerender" ] "actions" : [ }, "event" : "MessagesWidgetEditCommentForm", { { "truncateBody" : "true", } }, "action" : "rerender" ] ], "event" : "AcceptSolutionAction", LITHIUM.StarRating('#any', false, 1, 'LITHIUM:starRating'); { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1988689,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "disableKudosForAnonUser" : "false", ] { "entity" : "1988927", "event" : "MessagesWidgetEditCommentForm", ] { "initiatorDataMatcher" : "data-lia-kudos-id" }); }); "context" : "", "actions" : [ "actions" : [ }, { "dialogKey" : "dialogKey" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); { } LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; } "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); expireDate.setDate(expireDate.getDate() + 365*10); } "action" : "rerender" }, "action" : "rerender" ] { "event" : "MessagesWidgetEditAnswerForm", "context" : "lia-deleted-state", "action" : "rerender" }, document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "action" : "rerender" Ähnlich wie bei Handyverträgen ist eine Sonderkündigung für deinen DSL Vertrag in allen Fällen möglich, in denen Vodafone die vertraglich vereinbarten Leistungen nicht erbringt. LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'fj6KT0cU45dWEXpLEkN0xSWuRQGxjlGeUJf-yZ8yMyU. "event" : "MessagesWidgetEditCommentForm", "selector" : "#kudosButtonV2_8", "disableLinks" : "false", "actions" : [ "selector" : "#messageview_8", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "lia-deleted-state", "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "eventActions" : [ LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1988669,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ "includeRepliesModerationState" : "false", } "event" : "ProductMessageEdit", } LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", "eventActions" : [ { "action" : "pulsate" "context" : "envParam:selectedMessage", } "action" : "rerender" "}); ], { { "kudosable" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "event" : "addThreadUserEmailSubscription", { "event" : "unapproveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1989350,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", ;(function($) { "event" : "kudoEntity", "context" : "", LITHIUM.Dialog.options['2080537208'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); }, } { $('#node-menu li.has-sub>a').on('click', function(){ }, "componentId" : "forums.widget.message-view", "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", ], { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay_5', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "context" : "", "truncateBodyRetainsHtml" : "false", "context" : "envParam:quiltName,expandedQuiltName", ] "action" : "rerender" "context" : "", "context" : "envParam:quiltName,message", "selector" : "#kudosButtonV2_6", { { { "initiatorBinding" : true, }, "initiatorBinding" : true, } LITHIUM.Dialog.options['2107460018'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "forceSearchRequestParameterForBlurbBuilder" : "false", event.returnValue = false; }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1989350,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988654}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988669}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988689}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988738}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988875}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988904}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988927}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1989102}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1989350}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1989535}}]); "action" : "rerender" LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); }, { } } "event" : "MessagesWidgetEditCommentForm", }, "context" : "envParam:selectedMessage", "disableLabelLinks" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "message" : "1989350", "context" : "", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234206}); "disallowZeroCount" : "false", { "kudosable" : "true", }, "action" : "rerender" } }, { "closeEvent" : "LITHIUM:lightboxCloseEvent", { "event" : "RevokeSolutionAction", function setWarning(pagerId) { } "initiatorDataMatcher" : "data-lia-kudos-id" { { "event" : "removeMessageUserEmailSubscription", }, "event" : "MessagesWidgetEditCommentForm", watching = false; "action" : "rerender" { { { "actions" : [ { "disableLabelLinks" : "false", "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:quiltName,product,contextId,contextUrl", } ] "useSimpleView" : "false", "event" : "kudoEntity", setWarning(pagerId); }, } "action" : "rerender" { })(LITHIUM.jQuery); }); ] "action" : "rerender" "event" : "expandMessage", { ] "event" : "approveMessage", "kudosLinksDisabled" : "false", }, "action" : "pulsate" "action" : "rerender" { "componentId" : "kudos.widget.button", ] "event" : "approveMessage", { Der Grund hierfür ist die wiederholte Fehlabrechnung Ihrerseits. "context" : "", "action" : "pulsate" ] "event" : "ProductMessageEdit", "action" : "rerender" } "}); "action" : "rerender" ] { { ] "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); count++; { { watching = false; "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ;(function($) { })(LITHIUM.jQuery); { ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "action" : "pulsate" ] "actions" : [ "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, ], "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); }, "useTruncatedSubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_36","feedbackSelector":".InfoMessage"}); } "initiatorBinding" : true, "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" LITHIUM.Dialog({ { "disallowZeroCount" : "false", } else { }, }, "context" : "envParam:quiltName,message", } { LITHIUM.Dialog.options['-1190472718'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "removeMessageUserEmailSubscription", ] "action" : "rerender" ] }; "initiatorDataMatcher" : "data-lia-kudos-id" } "parameters" : { ] ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" }, { ] "event" : "ProductAnswerComment", "actions" : [ ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); Kommt es bei Ihnen zu deutlichen Leistungseinbrüchen und ist Ihr Anbieter selbst nach mehrmaliger Aufforderung nicht in der Lage, die Probleme zu beheben, kann das ein Grund für eine außerordentliche Kündigung … "useSubjectIcons" : "true", "action" : "rerender" LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); ], "event" : "editProductMessage", }); "context" : "", watching = false; "eventActions" : [ "context" : "", "action" : "rerender" "parameters" : { "event" : "MessagesWidgetAnswerForm", "actions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", }, ] { "triggerEvent" : "click", ] { "context" : "", "event" : "kudoEntity", }, } { "context" : "", "actions" : [ "context" : "", { "action" : "rerender" "componentId" : "kudos.widget.button", { count = 0; }, "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "actions" : [ ;(function($) { { "event" : "ProductAnswer", "kudosable" : "true", { "event" : "MessagesWidgetMessageEdit", { "action" : "pulsate" "event" : "ProductAnswerComment", "}); $('.css-menu').removeClass('cssmenu-open') "useTruncatedSubject" : "true", Ist es allerdings am neuen Wohnort technisch nicht möglich ihren Tarif fortzuführen, können Sie die vorzeitige Kündigung erklären. }, } { }, { { { $(document).ready(function(){ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "QuickReply", "event" : "kudoEntity", ] } "action" : "rerender" "event" : "addThreadUserEmailSubscription", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988654}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988669}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988689}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988738}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988875}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988904}},{"elementId":"link_30","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1988927}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1989102}},{"elementId":"link_38","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1989350}},{"elementId":"link_42","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1989535}}]); "forceSearchRequestParameterForBlurbBuilder" : "false", }); } "actions" : [ "disallowZeroCount" : "false", "initiatorBinding" : true, "actions" : [ { "useSimpleView" : "false", { "event" : "MessagesWidgetEditAction", "context" : "", { if ( count == neededkeys.length ) { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); }, "action" : "rerender" "initiatorBinding" : true, }, "action" : "pulsate" clearWarning(pagerId); "initiatorBinding" : true, "actions" : [ ], }, "context" : "", ', 'ajax'); "actions" : [ "context" : "envParam:selectedMessage", "useSubjectIcons" : "true", } ], } ] "}); "event" : "MessagesWidgetEditAnswerForm", "quiltName" : "ForumMessage", "message" : "1988927", "action" : "rerender" { "event" : "approveMessage", "context" : "", "action" : "rerender" "action" : "addClassName" { "context" : "lia-deleted-state", "selector" : "#messageview_1", }, "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "displaySubject" : "true", "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "actions" : [ "truncateBody" : "true", "actions" : [ $(document).ready(function(){ { o.innerHTML = "Page number can\'t exceed 2. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1988689,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. lithadmin: [] "revokeMode" : "true", "context" : "", }, "actions" : [ { }, ] ] { "}); LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ { } "action" : "rerender" "context" : "", "initiatorBinding" : true, var handleClose = function(event) { LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/330383","ajaxErrorEventName":"LITHIUM:ajaxError","token":"oZU8LsZJzOR-ez15Q08SDPuvGT5aA3vNldlUTL7UvKo. "; } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); } } "action" : "rerender" ] { "disableLabelLinks" : "false", "eventActions" : [ // Set start to true only if the first key in the sequence is pressed "context" : "", })(LITHIUM.jQuery); // Pull in global jQuery reference "context" : "", }, "disableKudosForAnonUser" : "false", "event" : "QuickReply", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/330383","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7Ow1L343fctOq3rfbM9dk8bacnksrYFnZvCzTiDGUZc. LITHIUM.InputEditForm("form_4", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "", "context" : "", "event" : "removeThreadUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,message", $(this).next().toggle(); { "useTruncatedSubject" : "true", }, watching = false; "context" : "lia-deleted-state", "action" : "rerender" "action" : "rerender" "eventActions" : [ { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "kudosLinksDisabled" : "false", } }, } "event" : "ProductMessageEdit", "event" : "MessagesWidgetEditCommentForm", "quiltName" : "ForumMessage", { "event" : "addThreadUserEmailSubscription", { } "kudosLinksDisabled" : "false", Tragen Sie Ihre Daten in die dafür vorgesehenen Felder ein. "context" : "", { { LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "MessagesWidgetEditAction", { }, Bist du sicher, dass du fortfahren möchtest? { { ] "actions" : [ ] "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#kudosButtonV2_7", "context" : "envParam:quiltName,product,contextId,contextUrl", } { ] disableInput(pagerId); { "action" : "rerender" "includeRepliesModerationState" : "false", { "action" : "rerender" "disableKudosForAnonUser" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "deleteMessage", } }); "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "context" : "envParam:entity", "event" : "deleteMessage", "action" : "rerender" } "action" : "pulsate" window.location = "https://forum.vodafone.de/t5/Archiv-Internet-Telefon-TV-%C3%BCber/Au%C3%9Ferordentliche-K%C3%BCndigung/td-p/1988654" + "/page/" + val; LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, { { { "context" : "", { "selector" : "#kudosButtonV2_7", "actions" : [ LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "disableKudosForAnonUser" : "false", "context" : "", } "action" : "rerender" "action" : "rerender" "componentId" : "kudos.widget.button", ] $('div[class*="-menu-btn"]').removeClass('active'); "parameters" : { ] { LITHIUM.Dialog.options['1366634396'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } "initiatorDataMatcher" : "data-lia-message-uid" "disableLinks" : "false", "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "disableLinks" : "false", { LITHIUM.AjaxSupport.ComponentEvents.set({ { ;(function($) { "actions" : [ { } { "showCountOnly" : "false", ] } "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", { { "kudosLinksDisabled" : "false", .attr('aria-expanded','true'); "event" : "MessagesWidgetMessageEdit", "context" : "lia-deleted-state", "action" : "rerender" } $(document).ready(function(){ return true; }, { "selector" : "#messageview_3", { "context" : "envParam:quiltName,product,contextId,contextUrl", ] "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.AjaxSupport.ComponentEvents.set({ } { } }, "initiatorBinding" : true, ] "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ }); { { "forceSearchRequestParameterForBlurbBuilder" : "false", "revokeMode" : "true", { LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "eventActions" : [ } } "actions" : [ }, }, "context" : "envParam:selectedMessage", LITHIUM.InputEditForm("form_3", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.