"action" : "rerender" "eventActions" : [ "initiatorDataMatcher" : "data-lia-message-uid" LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, "event" : "ProductAnswer", "event" : "approveMessage", { { ], } "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ { "actions" : [ "context" : "", { "context" : "", "kudosLinksDisabled" : "false", "context" : "envParam:feedbackData", { "context" : "", "event" : "markAsSpamWithoutRedirect", ] "displayStyle" : "horizontal", } { "context" : "", o.innerHTML = ""; } ] "useSimpleView" : "false", ] { { "actions" : [ "selector" : "#messageview_5", { var key = e.keyCode; }, "entity" : "1768509", o.innerHTML = "Page number can\'t exceed 2. ] "action" : "pulsate" $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); return false; LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'p-StmrM-8sS8tHMhMxQ3dea5SvlAwS4-_T6d-0CKuh4. { "context" : "envParam:quiltName,message,product,contextId,contextUrl", var neededkeys = [76, 79, 71, 77, 69, 73, 78]; }, von DarkStar » 18.02.2019, 08:55, Beitrag "event" : "MessagesWidgetAnswerForm", }, }, "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ { { "event" : "deleteMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_42","feedbackSelector":".InfoMessage"}); "event" : "approveMessage", }, }); "event" : "MessagesWidgetAnswerForm", "actions" : [ } "action" : "rerender" } }, "action" : "rerender" "disableLinks" : "false", { "context" : "", "quiltName" : "ForumMessage", "disableKudosForAnonUser" : "false", "selector" : "#kudosButtonV2_6", { "actions" : [ "action" : "rerender" { "actions" : [ "actions" : [ { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } "event" : "unapproveMessage", { "actions" : [ "kudosable" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "useTruncatedSubject" : "true", "selector" : "#kudosButtonV2_8", "entity" : "1768401", ] ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1768349 .lia-rating-control-passive', '#form_2'); "eventActions" : [ // If watching, pay attention to key presses, looking for right sequence. { } "action" : "pulsate" "disableKudosForAnonUser" : "false", LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); "action" : "rerender" { "actions" : [ "context" : "", "action" : "addClassName" "context" : "", "truncateBodyRetainsHtml" : "false", } "context" : "", "kudosLinksDisabled" : "false", ] "useCountToKudo" : "false", { { "context" : "", "action" : "rerender" LITHIUM.Dialog.options['1330891022'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; ] }, "kudosLinksDisabled" : "false", "context" : "", if ( !watching ) { "actions" : [ "disableKudosForAnonUser" : "false", "action" : "rerender" "actions" : [ }, }); "parameters" : { } "truncateBodyRetainsHtml" : "false", "context" : "", }, // Reset the conditions so that someone can do it all again. Nutzungsbedingungen. }, ] "action" : "rerender" var neededkeys = [76, 79, 71, 77, 69, 73, 78]; ] "disallowZeroCount" : "false", ] ] } "action" : "rerender" watching = false; LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { }, }, ;(function($) { { } { Unitymedia) allgemein, ↳   Technik (WLAN-Router, Kabelmodems, Verkabelung...), ↳   Arris, Technicolor, Compal, Sagemcom und Hitron, ↳   Störungen, Ausfälle und Speedprobleme, ↳   Kabelanschluss und Vodafone Basic TV bzw. document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "context" : "", "actions" : [ "context" : "envParam:selectedMessage", "disableLabelLinks" : "false", } // We made it! { ] { "componentId" : "kudos.widget.button", $(this).toggleClass('active'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "event" : "removeThreadUserEmailSubscription", "action" : "rerender" "actions" : [ "}); }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1768409 .lia-rating-control-passive', '#form_6'); "event" : "addMessageUserEmailSubscription", ] "actions" : [ "action" : "pulsate" ] }, "action" : "pulsate" { "action" : "rerender" }, { "displaySubject" : "true", { "actions" : [ "actions" : [ { "event" : "MessagesWidgetEditAnswerForm", "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_4', 'GiveRating', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); o.innerHTML = "Page number can\'t exceed 2. "event" : "removeThreadUserEmailSubscription", return; } { "action" : "rerender" } } } "displaySubject" : "true", LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_38cc410f4b8024","nodesModel":{"Archiv|forum-board":{"title":"Board-Suche: Archiv_Internet-Telefon-TV-über-Kabel","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Internet-Telefon-TV-über-Kabel","inputSelector":".lia-search-input-message"},"Vertrag|category":{"title":"Kategorie-Suche: Archiv_Internet-Telefon-TV-über-Kabel","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_38cc410f4b8024_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); { }, ] ] "actions" : [ "action" : "rerender" "action" : "rerender" ] "context" : "", }, } "selector" : "#messageview_4", } { "activecastFullscreen" : false, "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.useTickets = false; { "truncateBody" : "true", // Register the click event handler "context" : "envParam:quiltName,message", } "event" : "QuickReply", "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "displaySubject" : "true", "action" : "rerender" "actions" : [ } { } else { "componentId" : "forums.widget.message-view", } "dialogContentCssClass" : "lia-panel-dialog-content", "componentId" : "forums.widget.message-view", }, } }, "disableLinks" : "false", "event" : "expandMessage", "componentId" : "kudos.widget.button", "event" : "MessagesWidgetCommentForm", }, }, function disableInput(pagerId) { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "action" : "rerender" }, "actions" : [ }, }, "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/281739","ajaxErrorEventName":"LITHIUM:ajaxError","token":"0uRZH9SPZRoYNIjAxr24VL6yvJ1SfLXY7iQFrtYl7fo. LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "}); LITHIUM.Dialog.options['247698320'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:quiltName", }, "event" : "addThreadUserEmailSubscription", "event" : "approveMessage", "context" : "", { "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", "actions" : [ Για την υπηρεσία Vodafone TV απαιτείται χρήση του εξοπλισμού της Vodafone που σας παρέχεται δωρεάν, καθώς και επιπλέον ψηφιακός εξοπλισμός αξίας … }, }, "initiatorBinding" : true, "truncateBody" : "true", "forceSearchRequestParameterForBlurbBuilder" : "false", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSubjectIcons" : "true", { } "event" : "MessagesWidgetEditAction", "useCountToKudo" : "false", "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "showCountOnly" : "false", } "action" : "rerender" { "actions" : [ "action" : "pulsate" "context" : "envParam:entity", $(document).ready(function(){ }, { ] { Die Modems von Vodafone lassen sich im Kundencenter in den Bridge-Modus versetzen. "event" : "ProductMessageEdit", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/0F94F452D57A978C27D2D3E5195EDB37/responsive_peak/images/button_dialog_close.svg", { LITHIUM.StarRating('#any_6', false, 1, 'LITHIUM:starRating'); { "actions" : [ "action" : "rerender" "context" : "envParam:selectedMessage", "selector" : "#kudosButtonV2_8", var clickedDomElement = $(this); "action" : "rerender" "useTruncatedSubject" : "true", "includeRepliesModerationState" : "false", } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "initiatorBinding" : true, if (val.trim() == "") ] "action" : "rerender" "actions" : [ { "initiatorDataMatcher" : "data-lia-message-uid" { ] { "actions" : [ "event" : "QuickReply", if ( key == neededkeys[0] ) { { ] }, "event" : "MessagesWidgetEditAnswerForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/281739","ajaxErrorEventName":"LITHIUM:ajaxError","token":"RgvFr4pN7bNpsh-TbLuWCQD4RN9qVWuJRFVevySjaSk. "actions" : [ }, "event" : "MessagesWidgetCommentForm", { }, { "actions" : [ { "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", ] } { }, } { "actions" : [ "action" : "rerender" "action" : "rerender" LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { } LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'PtW3x1YxkMys1tax96DZKxCJSZTa4Kd0xU5O0N9cRdo. { { "disableLabelLinks" : "false", { .attr('aria-hidden','false') "action" : "rerender" "action" : "rerender" "actions" : [ { } ] "defaultAriaLabel" : "", { "event" : "deleteMessage", "action" : "rerender" ] }, "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:selectedMessage", { "quiltName" : "ForumMessage", "selector" : "#kudosButtonV2_3", } })(LITHIUM.jQuery); { "parameters" : { }, } "event" : "MessagesWidgetMessageEdit", ] }, "action" : "addClassName" LITHIUM.AjaxSupport.ComponentEvents.set({ ;(function($) { "event" : "ProductAnswer", { ] { ] { }); "includeRepliesModerationState" : "false", } "context" : "envParam:quiltName,expandedQuiltName", ] "event" : "QuickReply", ] // just for convenience, you need a login anyways... "actions" : [ { "event" : "ProductMessageEdit", { { } else { ', 'ajax'); ] ] "revokeMode" : "true", "kudosable" : "true", "context" : "envParam:quiltName,message,product,contextId,contextUrl", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_45","feedbackSelector":".InfoMessage"}); { LITHIUM.Dialog.options['471069624'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, "entity" : "1768509", "action" : "rerender" "event" : "ProductAnswerComment", } LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ } "event" : "deleteMessage", }, "action" : "addClassName" "initiatorBinding" : true, ] "message" : "1768421", ] "action" : "rerender" } } "displayStyle" : "horizontal", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1768342 .lia-rating-control-passive', '#form_1'); lithadmin: [] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] ] $(document).ready(function(){ ', 'ajax'); "kudosLinksDisabled" : "false", "quiltName" : "ForumMessage", "actions" : [ setWarning(pagerId); "action" : "rerender" { "context" : "", "context" : "", document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); { } }, }, { "}); }, "}); "event" : "MessagesWidgetEditCommentForm", } } { { "context" : "envParam:quiltName", { "event" : "ProductAnswer", ] LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { "event" : "RevokeSolutionAction", $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); "context" : "", "eventActions" : [ return true; { ] "action" : "rerender" ] "disableLinks" : "false", "actions" : [ ] }, LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_38cc410f4b8024","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); LITHIUM.AjaxSupport.ComponentEvents.set({ } ] { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); { "actions" : [ "context" : "", "actions" : [ }, Bist du sicher, dass du fortfahren möchtest? ] { { } return false; }, "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_9","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "ProductAnswerComment", "parameters" : { { "actions" : [ "actions" : [ "actions" : [ } { "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", } "context" : "", } "context" : "envParam:feedbackData", { { "}); "event" : "ProductAnswerComment", }, ] "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ "useCountToKudo" : "false", "action" : "rerender" } { "context" : "envParam:quiltName", "quiltName" : "ForumMessage", }, Senedir ara sıra kopmalar olsa da iyi kötü idare ediyordum ama şu 1 aydır oyuna bağlanamıyorum. { "actions" : [ "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", ] "action" : "pulsate" "action" : "rerender" "actions" : [ window.scrollTo(0,position_x.top - 150); "actions" : [ }); { "actions" : [ "useSimpleView" : "false", "disallowZeroCount" : "false", "message" : "1768509", { "event" : "ProductAnswer", }, ] "event" : "removeThreadUserEmailSubscription", "actions" : [ "actions" : [ }, "event" : "MessagesWidgetCommentForm", "actions" : [ "action" : "rerender" ] { }, "action" : "rerender" } } { { "componentId" : "kudos.widget.button", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1767604,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "expandMessage", "messageViewOptions" : "1111110111111111111110111110100101001101" "actions" : [ "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); }); { }, { "context" : "envParam:entity", } ;(function($) { LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'oCSA1yrxpqzISzpVpkocjIhks4i4TPklIQdkjJpysUc. } ] "context" : "envParam:feedbackData", }, { "actions" : [ } Denn viele Computer, Smartphones oder Geräte wie … ] "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "revokeMode" : "true", { ] LITHIUM.Dialog.options['-1291586278'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "action" : "addClassName" "event" : "removeThreadUserEmailSubscription", function processPageInputBlur(pagerId, val) }, { { "context" : "", { } ] "event" : "editProductMessage", "includeRepliesModerationState" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/281739","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gHq6yfgCG-YccmOJjcpCJwr8D3zOhhl4CICpbVyPWBw. { "parameters" : { { ] "context" : "", }, { "event" : "removeMessageUserEmailSubscription", "forceSearchRequestParameterForBlurbBuilder" : "false", { }, "componentId" : "kudos.widget.button", }, } } "eventActions" : [ }, } "triggerSelector" : ".lia-panel-dialog-trigger-event-click", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); } } else { "kudosLinksDisabled" : "false", { "context" : "envParam:quiltName", }, "actions" : [ { "actions" : [ "event" : "MessagesWidgetCommentForm", "actions" : [ "context" : "", if ( Number(val) > 2 ) return false; }, "revokeMode" : "true", "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "linkDisabled" : "false" "displayStyle" : "horizontal", "context" : "", "truncateBodyRetainsHtml" : "false", }, "context" : "", { }, "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); count++; }, } { } ] "context" : "envParam:quiltName", ] ] "disableKudosForAnonUser" : "false", "truncateBodyRetainsHtml" : "false", ] }, "action" : "addClassName" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "parameters" : { { { "displayStyle" : "horizontal", o.innerHTML = "Page must be an integer number. }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); }, }, }, { "displayStyle" : "horizontal", "displaySubject" : "true", ] "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv/thread-id/281739","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BWc6s8Rtp0QEJI5La4nb7CIVkdSkkQ303QK0oRuK_vw. "context" : "envParam:quiltName", "initiatorDataMatcher" : "data-lia-kudos-id" "}); ] "context" : "lia-deleted-state", { "action" : "rerender" { } } "action" : "rerender" LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" { ","loaderSelector":"#lineardisplaymessageviewwrapper_6 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "eventActions" : [ { "action" : "rerender" "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "context" : "envParam:quiltName,product,contextId,contextUrl", LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren.